PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1796s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ARF
Protein Properties Length: 1168aa    MW: 129220 Da    PI: 6.912
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1796s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.45.6e-23127228199
                          EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                          f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F +
  Cagra.1796s0004.1.p 127 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIR 215
                          99*****************************98888885.9************************************************5 PP

                          -SSSEE..EEEEE-S CS
                   B3  85 dgrsefelvvkvfrk 99 
                            + +++l+++++r+
  Cagra.1796s0004.1.p 216 --DGKAQLLLGIRRA 228
                          ..4678889999997 PP

2Auxin_resp117.51.1e-38253335183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+nS+Wr+L+
  Cagra.1796s0004.1.p 253 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 335
                          799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-42117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-41121242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.06E-19126227No hitNo description
PROSITE profilePS5086312.125127229IPR003340B3 DNA binding domain
SMARTSM010199.7E-23127229IPR003340B3 DNA binding domain
PfamPF023623.1E-21127228IPR003340B3 DNA binding domain
PfamPF065071.0E-33253335IPR010525Auxin response factor
PfamPF023091.8E-910381126IPR033389AUX/IAA domain
PROSITE profilePS5174526.95610401133IPR000270PB1 domain
SuperFamilySSF542771.03E-810531118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1168 aa     Download sequence    Send to blast
MKAPSSNGVS PNPVEGERRN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDFIPSYPN LPSKLICMLH NVTLNADPET DEVYAQMTLQ PVNKYDRDAL LASDMGLKLN  120
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR  180
HIYRGQPKRH LLTTGWSVFV STKRLFAGDS VLFIRDGKAQ LLLGIRRANR QQPALSSSVI  240
SSDSMHIGVL AAAAHANANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMI  300
FETEECGVRR YMGTVTGISD LDPVRWKNSQ WRNLQIGWDE SAAGDRPSRV SVWDIEPVLT  360
PFYICPPPFF RPRFGGQPGM PDDDTDMESA LKRAMPWLDN SSEMKDASST IFPGLSLVQW  420
MNMQQQQQNG QLPSAAAQPG FFPSMLSPTT ALHNNLGGTD DPSKLLSFQM PQGGISSSNL  480
QFNKPNVQSP MSQLPQPSTT LSQQQQLQQL LHSSLNQQQQ QSQSQQQQQQ QLLQQQQQLQ  540
SQQHSNNNQS QSQQQQQQQH LQQQQQQQHQ QPLQQQTQQQ QQRTQSLQSH SHSQPQPQPQ  600
PQPQPHKLQQ LQLPQNQLYN GQQAAQQLQA QQHLQPQLVS GSMASSAITP PSSSHNQSFQ  660
QQQQSKKLQQ AHHHLGASTC QSSVIETSKS SSNLMSVPPQ ETQFQRQVEQ QQPPGLSGQN  720
QQTLLQQKAH QAQAQQIFQQ SLLEQPHLQF QLLQRLQQQQ QQQQQQQFLS PQSQLPHHQL  780
QSQQLQQLPA LSQGHQFPSS CTNNGLSTLQ PPQMLVSRPQ EKQHPPVGGG VKAYSGITDG  840
GDAPSSSTSP STNNCQISSS GFLNRTQSGP AILIPDAAID MSSNLVQDLY SKSDMRLKQE  900
LVGQQKSKAS LTDHHLEASA SGTSYGLDGG DNNRQQNFLA PTFGLDGDSR NSLLGGANVD  960
NGFVPDTLLS RGYDSQKDLQ NMLSNYGGVT TDIGTEMSTS AVRTQSFGVP NVPAISNDLA  1020
VNDAGVLGGG LWPAQTQRMR TYTKVQKRGS VGRSIDVNRY RGYDELRHDL ARMFGIEGQL  1080
EDPQTSDWKL VYVDHENDIL LVGDDPWEEF VNCVQSIKIL SSAEVQQMSL DGNFAGVPVT  1140
NQACSGGDSG NAWRGHYDDN SATSFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1692135651388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0421950.0AF042195.1 Arabidopsis thaliana auxin response factor 7 (ARF7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM4CDP60.0M4CDP6_BRARP; Auxin response factor
STRINGBra002327.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein